PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05160.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 372aa    MW: 39994.3 Da    PI: 9.7474
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05160.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.87.5e-16289331547
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                              +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+ 
  Rsa1.0_05160.1_g00002.1 289 RRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENEELQR 331
                              79************************************99874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-12285349IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.185287332IPR004827Basic-leucine zipper domain
PfamPF001704.1E-13289331IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.44E-11289335No hitNo description
CDDcd147071.88E-26289333No hitNo description
Gene3DG3DSA:1.20.5.1708.3E-15289332No hitNo description
PROSITE patternPS000360292307IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MNFKNNNNMG NEPPGGGGAL TRQGSIYSLT FDEFQSSLGK DFGSMNMDEL LKNIWTAEET  60
QAMSVAASTS GVIPLALGSQ EGLLPLQRQG SLTLPRTLST KTVDQVWKDL SGTNLTQSQS  120
QTLGEVTLEE FLVRAGVVRE EAQIAAKDVN VGFSVQASPQ VVPGLMGNLG AETVNHTQVQ  180
GSSLPLNVNG ARSTYQQQPI MPKQPGFGYG AQVGPGIRGG LMGLGDQSLT NNMGLVQGVV  240
GAVSPVTPLS ADGIGKSNGD SSSLSPSPYM FNGGVRGRKS GAVEKVVERR QRRMIKNRES  300
AARSRARKQA YTVELEAEVA KLKEENEELQ RKQPLCVLQA KIMEIQKNQE MEMMNIQGGA  360
KKRLRRTESG PW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6165270.0HE616527.1 Brassica napus mRNA for abscisic acid responsive elements-binding factor 2 (abf2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013718815.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
RefseqXP_013718814.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
SwissprotQ9M7Q40.0AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0D3CNT10.0A0A0D3CNT1_BRAOL; Uncharacterized protein
STRINGBra040260.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-155abscisic acid responsive elements-binding factor 2